Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL23A Rabbit Polyclonal Antibody (HRP)

RPL23A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L23A, MDA20

UniProt

O75818

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3R)-3,6-Dihydro-2H-1,4-thiazine-3,5-dicarboxylic Acid 3-Ethyl Ester
TRC-D450660-50MG 50 mg

(3R)-3,6-Dihydro-2H-1,4-thiazine-3,5-dicarboxylic Acid 3-Ethyl Ester

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF640R conjugate, 0.1mg/mL
BNC400768-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS502523 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561702 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
APC Anti-Human CD184/CXCR4 Antibody[12G5]
E-AB-F1157E-01 20 Tests

APC Anti-Human CD184/CXCR4 Antibody[12G5]

Sign In for Pricing
View Details
APC Anti-Human CD184/CXCR4 Antibody[12G5]
E-AB-F1157E-02 100 Tests

APC Anti-Human CD184/CXCR4 Antibody[12G5]

Sign In for Pricing
View Details