Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3F Rabbit Polyclonal Antibody (HRP)

EIF3F Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRT67, EIF3S5, eIF3-p47

UniProt

O00303

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human TLR2 protein, His
orb1817213-01 20 µg

Recombinant human TLR2 protein, His

Sign In for Pricing
View Details
Recombinant human TLR2 protein, His
orb1817213-02 100 µg

Recombinant human TLR2 protein, His

Sign In for Pricing
View Details
Recombinant human TLR2 protein, His
orb1817213-03 500 µg

Recombinant human TLR2 protein, His

Sign In for Pricing
View Details
SPARC ELISA Kit (Rat) (OKEH04376)
OKEH04376 96 Well

SPARC ELISA Kit (Rat) (OKEH04376)

Sign In for Pricing
View Details
ZNF124 Human siRNA Oligo Duplex (Locus ID 7678)
SR305203 1 Kit

ZNF124 Human siRNA Oligo Duplex (Locus ID 7678)

Sign In for Pricing
View Details
TP53 Rabbit Polyclonal Antibody (FITC)
orb2081424 100 µL

TP53 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details