Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP3 Rabbit Polyclonal Antibody (HRP)

CDK5RAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C53, IC53, LZAP, HSF-27, MST016, PP1553, OK/SW-cl.114

UniProt

Q96JB5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_788276

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-ArmPEG-DF, 20K
A88051-20K Inquire

8-ArmPEG-DF, 20K

Sign In for Pricing
View Details
Mouse PLIN1 (Perilipin 1) ELISA Kit
MBS8803841-01 48 Well

Mouse PLIN1 (Perilipin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse PLIN1 (Perilipin 1) ELISA Kit
MBS8803841-02 96 Well

Mouse PLIN1 (Perilipin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse PLIN1 (Perilipin 1) ELISA Kit
MBS8803841-03 5x 96 Well

Mouse PLIN1 (Perilipin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse PLIN1 (Perilipin 1) ELISA Kit
MBS8803841-04 10x 96 Well

Mouse PLIN1 (Perilipin 1) ELISA Kit

Sign In for Pricing
View Details
Sulpiride EP Impurity F
RM-S161806-01 10 mg

Sulpiride EP Impurity F

Sign In for Pricing
View Details