Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptpn7 Rabbit Polyclonal Antibody (Biotin)

Ptpn7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Heptp, Lcptp

UniProt

P49445

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ptpn7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663716

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-136 miRNA Inhibitor
MIM01169 2x 5.0 nmol

mmu-miR-136 miRNA Inhibitor

Sign In for Pricing
View Details
Hif1a Knockout TM3 Cell Line
ARG43905 1 Million

Hif1a Knockout TM3 Cell Line

Sign In for Pricing
View Details
EphB2 Knockout PATU8988T Polyclonal Cells
ARG11341 1 Million

EphB2 Knockout PATU8988T Polyclonal Cells

Sign In for Pricing
View Details
GATA2 (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, MGC2306) (PE)
127184-PE 100 µL

GATA2 (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, MGC2306) (PE)

Sign In for Pricing
View Details
Hepatitis C Virus Mouse Monoclonal Antibody
orb334827-01 30 µL

Hepatitis C Virus Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Hepatitis C Virus Mouse Monoclonal Antibody
orb334827-02 50 μL

Hepatitis C Virus Mouse Monoclonal Antibody

Sign In for Pricing
View Details