Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptpn7 Rabbit Polyclonal Antibody (FITC)

Ptpn7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Heptp, Lcptp

UniProt

P49445

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ptpn7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663716

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Med17 AAV siRNA Pooled Vector
28301166 1.0 µg

Med17 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SIGLEC8 Antibody - C-terminal region
MBS3219587-01 0.1 mL

SIGLEC8 Antibody - C-terminal region

Sign In for Pricing
View Details
SIGLEC8 Antibody - C-terminal region
MBS3219587-02 5x 0.1 mL

SIGLEC8 Antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Gamma-aminobutyric acid,GABA ELISA Kit
CN-02725M1 96T

Mouse Gamma-aminobutyric acid,GABA ELISA Kit

Sign In for Pricing
View Details
NavB2 (Na Beta 2, Beta 2 subunit of Voltage-gated Sodium Channel, Scn2b) discontinued
N0530 50 µL

NavB2 (Na Beta 2, Beta 2 subunit of Voltage-gated Sodium Channel, Scn2b) discontinued

Sign In for Pricing
View Details
MSMP-set siRNA/shRNA/RNAi Lentivector (Human)
30752091 4x 500 ng

MSMP-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details