Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intrinsic Factor/GIF, Human (HEK293, His)

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Intrinsic Factor/GIF Protein, Human (HEK293, His) is the recombinant human-derived Intrinsic Factor/GIF protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

Intrinsic Factor/GIF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/intrinsic-factor-gif-protein-human-hek293-his.html

Purity

96.90

Smiles

STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Molecular Formula

2694 (Gene_ID) P27352-1 (S19-Y417) (Accession)

Molecular Weight

Approximately 49 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- ((4-Methoxyphenyl) sulfonyl) -N- (4-phenoxyphenyl) piperidine-4-carboxamide
OR1061456-01 100 mg

1- ((4-Methoxyphenyl) sulfonyl) -N- (4-phenoxyphenyl) piperidine-4-carboxamide

Sign In for Pricing
View Details
1- ((4-Methoxyphenyl) sulfonyl) -N- (4-phenoxyphenyl) piperidine-4-carboxamide
OR1061456-02 250 mg

1- ((4-Methoxyphenyl) sulfonyl) -N- (4-phenoxyphenyl) piperidine-4-carboxamide

Sign In for Pricing
View Details
1- ((4-Methoxyphenyl) sulfonyl) -N- (4-phenoxyphenyl) piperidine-4-carboxamide
OR1061456-03 1 g

1- ((4-Methoxyphenyl) sulfonyl) -N- (4-phenoxyphenyl) piperidine-4-carboxamide

Sign In for Pricing
View Details
Vmn2r27 Double Nickase Plasmid (m2)
sc-433162-NIC-2 20 µg

Vmn2r27 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Human IL28B HEK293 Overexpression Lysate
MBS8114813-01 0.3 mg

Human IL28B HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human IL28B HEK293 Overexpression Lysate
MBS8114813-02 5x 0.3 mg

Human IL28B HEK293 Overexpression Lysate

Sign In for Pricing
View Details