Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG5 Rabbit Polyclonal Antibody (HRP)

BAG5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BAG-5

UniProt

Q9UL15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001015049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNIP1 (TNFAIP3-interacting Protein 1, VAN, NAF1, ABIN-1, NIP40-1) (MaxLight 750)
MBS6441091-01 0.1 mL

TNIP1 (TNFAIP3-interacting Protein 1, VAN, NAF1, ABIN-1, NIP40-1) (MaxLight 750)

Sign In for Pricing
View Details
TNIP1 (TNFAIP3-interacting Protein 1, VAN, NAF1, ABIN-1, NIP40-1) (MaxLight 750)
MBS6441091-02 5x 0.1 mL

TNIP1 (TNFAIP3-interacting Protein 1, VAN, NAF1, ABIN-1, NIP40-1) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Polyclonal SARS-CoV-2 Spike Antibody [mFluor Violet 610 SE]
NBP3-12852MFV610 0.1 mL

Rabbit Polyclonal SARS-CoV-2 Spike Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Human Twist Transcription Factor (TWIST) ELISA Kit
RDR-TWIST-Hu-96Tests 96 Tests

Human Twist Transcription Factor (TWIST) ELISA Kit

Sign In for Pricing
View Details
Recombinant Interferon Beta (IFNb)
TRV-0062346-01 10 µg

Recombinant Interferon Beta (IFNb)

Sign In for Pricing
View Details
Recombinant Interferon Beta (IFNb)
TRV-0062346-02 50 µg

Recombinant Interferon Beta (IFNb)

Sign In for Pricing
View Details