Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMO Rabbit Polyclonal Antibody (HRP)

TRMO Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAP1, HSPC219, C9orf156

UniProt

Q9BU70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_057565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE1A Antibody, FITC conjugated
CSB-PA22739C0Rb-01 50 μL

PDE1A Antibody, FITC conjugated

Sign In for Pricing
View Details
PDE1A Antibody, FITC conjugated
CSB-PA22739C0Rb-02 100 µL

PDE1A Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Sesn2 qPCR Primer Pair
QM08494S 200 Tests

Mouse Sesn2 qPCR Primer Pair

Sign In for Pricing
View Details
Rat Tubulin Beta (TUBB) ELISA Kit
orb1947081-01 48 Tests

Rat Tubulin Beta (TUBB) ELISA Kit

Sign In for Pricing
View Details
Rat Tubulin Beta (TUBB) ELISA Kit
orb1947081-02 96 Tests

Rat Tubulin Beta (TUBB) ELISA Kit

Sign In for Pricing
View Details
PKA gamma Rabbit pAb, IRDye 800CW conjugated
orb2820018 100 µL

PKA gamma Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details