Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMO Rabbit Polyclonal Antibody (HRP)

TRMO Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAP1, HSPC219, C9orf156

UniProt

Q9BU70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_057565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute Carrier family 16 (member 3 (SLC16A3) Human ELISA Kit
H1988 96 Tests

Solute Carrier family 16 (member 3 (SLC16A3) Human ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse 4932438H23Rik shRNA (UAS) - Lentiviral mouse 4932438H23Rik shRNA (UAS, RFP) (100)
GTR15283680 1 Vial

Lentiviral mouse 4932438H23Rik shRNA (UAS) - Lentiviral mouse 4932438H23Rik shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-Mouse CD1d Antibody (20H2 (HB323) )
HY-P990807 1 Each

Anti-Mouse CD1d Antibody (20H2 (HB323) )

Sign In for Pricing
View Details
EDG2 Peptide
AF5322-BP 1 mg

EDG2 Peptide

Sign In for Pricing
View Details
General Diacylglycerol (DAG) ELISA Kit
orb781983-01 48 Tests

General Diacylglycerol (DAG) ELISA Kit

Sign In for Pricing
View Details
General Diacylglycerol (DAG) ELISA Kit
orb781983-02 96 Tests

General Diacylglycerol (DAG) ELISA Kit

Sign In for Pricing
View Details