Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES3 Rabbit Polyclonal Antibody (Biotin)

CES3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ES31

UniProt

Q6UWW8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQKQKNRKAQEDL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079198

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA5 CRISPRa sgRNA lentivector (set of three targets)(Human)
24004121 3x 1.0µg DNA

HSPA5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
NR2E3 Polyclonal Antibody, FITC Conjugated
bs-11572R-FITC 100 µL

NR2E3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (MaxLight 405)
MBS6372756-01 0.1 mL

CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (MaxLight 405)

Sign In for Pricing
View Details
CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (MaxLight 405)
MBS6372756-02 5x 0.1 mL

CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Monoclonal Von Willebrand Factor Antibody (VWF/7979R) [FITC]
NBP3-21110F 0.1 mL

Rabbit Monoclonal Von Willebrand Factor Antibody (VWF/7979R) [FITC]

Sign In for Pricing
View Details
Anti-Mouse-ear cress Nup1/Nup136 Antibody
MBS1759623-01 0.2 mL

Anti-Mouse-ear cress Nup1/Nup136 Antibody

Sign In for Pricing
View Details