Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA1 Rabbit Polyclonal Antibody (HRP)

P4HA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P4HA

UniProt

C9JL12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001136068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MitoROS Brite™ 570 *Optimized for Detecting Reactive Oxygen Species (ROS) in Mitochondria*
15998-AAT 1 mg

MitoROS Brite™ 570 *Optimized for Detecting Reactive Oxygen Species (ROS) in Mitochondria*

Sign In for Pricing
View Details
DKFZp451M2119 Human qPCR Primer Pair (NM_182585)
HP219129 200 Reactions

DKFZp451M2119 Human qPCR Primer Pair (NM_182585)

Sign In for Pricing
View Details
Azilsartan Imidazole Carbonyl Dioxolene Ester
TRC-A926935-5MG 5 mg

Azilsartan Imidazole Carbonyl Dioxolene Ester

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL
BNC042428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PROS1 Polyclonal Antibody
E-AB-14444-01 20 µL

PROS1 Polyclonal Antibody

Sign In for Pricing
View Details
PROS1 Polyclonal Antibody
E-AB-14444-02 60 µL

PROS1 Polyclonal Antibody

Sign In for Pricing
View Details