Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wsb1 Rabbit Polyclonal Antibody (HRP)

Wsb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

B3DM89

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Wsb1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPWSQCLKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPREHIIDCGDIV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001036026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nematode Super Broth (Powder)
N1006 500 g

Nematode Super Broth (Powder)

Sign In for Pricing
View Details
Human LMTK2 qPCR Primer Pair
QH34093S 200 Tests

Human LMTK2 qPCR Primer Pair

Sign In for Pricing
View Details
FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (MaxLight 650)
MBS6297985-01 0.1 mL

FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (MaxLight 650)

Sign In for Pricing
View Details
FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (MaxLight 650)
MBS6297985-02 5x 0.1 mL

FANCB, ID (FANCB, Fanconi anemia group B protein, Fanconi anemia-associated polypeptide of 95kD) (MaxLight 650)

Sign In for Pricing
View Details
Rno-miR-1249 miRNA Agomir
orb1916404-01 5 nmol

Rno-miR-1249 miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-1249 miRNA Agomir
orb1916404-02 10 nmol

Rno-miR-1249 miRNA Agomir

Sign In for Pricing
View Details