Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGAP1 Rabbit Polyclonal Antibody (FITC)

AGAP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GGAP1, AGAP-1, CENTG2, cnt-g2

UniProt

Q9UPQ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human AGAP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF3s8 (EIF3C) (NM_001037808) Human Tagged Lenti ORF Clone
RC201705L3 10 µg

eIF3s8 (EIF3C) (NM_001037808) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ARID1B/BAF250B Antibody [M24N11]
C21646-20uL 20 µL

ARID1B/BAF250B Antibody [M24N11]

Sign In for Pricing
View Details
Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)
MBS1071866-01 0.02 mg (E-Coli)

Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)

Sign In for Pricing
View Details
Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)
MBS1071866-02 0.1 mg (E-Coli)

Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)

Sign In for Pricing
View Details
Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)
MBS1071866-03 0.02 mg (Yeast)

Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)

Sign In for Pricing
View Details
Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)
MBS1071866-04 0.1 mg (Yeast)

Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)

Sign In for Pricing
View Details