Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD5 Rabbit Polyclonal Antibody (Biotin)

ENTPD5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PCPH, CD39L4, NTPDase-5

UniProt

O75356

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB10 Recombinant Protein Antigen
NBP1-83714PEP 0.1 mL

ZBTB10 Recombinant Protein Antigen

Sign In for Pricing
View Details
Canine Anti-Phospholipase A2 Antibody ELISA Kit
MBS748937-01 48 Well

Canine Anti-Phospholipase A2 Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Phospholipase A2 Antibody ELISA Kit
MBS748937-02 96 Well

Canine Anti-Phospholipase A2 Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Phospholipase A2 Antibody ELISA Kit
MBS748937-03 5x 96 Well

Canine Anti-Phospholipase A2 Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Phospholipase A2 Antibody ELISA Kit
MBS748937-04 10x 96 Well

Canine Anti-Phospholipase A2 Antibody ELISA Kit

Sign In for Pricing
View Details
Ezrin (EZR) (NM_003379) Human Tagged Lenti ORF Clone
RC200404L1 10 µg

Ezrin (EZR) (NM_003379) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details