Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOSR2 Rabbit Polyclonal Antibody (FITC)

GOSR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bos1, EPM6, GS27

UniProt

O14653

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004278

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COLQ Rabbit Polyclonal Antibody
orb575265 100 µL

COLQ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit
MBS9359592-01 48 Well

Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit

Sign In for Pricing
View Details
Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit
MBS9359592-02 96 Well

Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit

Sign In for Pricing
View Details
Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit
MBS9359592-03 5x 96 Well

Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit

Sign In for Pricing
View Details
Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit
MBS9359592-04 10x 96 Well

Camel Probable E3 Ubiquitin-Protein Ligase MYCBP2 (MYCBP2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human NPL Protein, His, E.coli-1mg
QP12870-1mg 1mg

Recombinant Human NPL Protein, His, E.coli-1mg

Sign In for Pricing
View Details