Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIPRL Rabbit Polyclonal Antibody (HRP)

TIPRL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIP, TIP41, TIPRL1

UniProt

O75663

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_690866

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ME1 (Malic Enzyme 1, MES, HUMNDME) (PE)
MBS6426418-01 0.1 mL

ME1 (Malic Enzyme 1, MES, HUMNDME) (PE)

Sign In for Pricing
View Details
ME1 (Malic Enzyme 1, MES, HUMNDME) (PE)
MBS6426418-02 5x 0.1 mL

ME1 (Malic Enzyme 1, MES, HUMNDME) (PE)

Sign In for Pricing
View Details
RALGPS2 (Ras-specific Guanine Nucleotide-releasing Factor RalGPS2, RalA Exchange Factor RalGPS2, Ral GEF with PH Domain and SH3-binding Motif 2, FLJ10244, FLJ25604) (HRP)
132292-HRP 100 µL

RALGPS2 (Ras-specific Guanine Nucleotide-releasing Factor RalGPS2, RalA Exchange Factor RalGPS2, Ral GEF with PH Domain and SH3-binding Motif 2, FLJ10244, FLJ25604) (HRP)

Sign In for Pricing
View Details
Anti-KMT1B/SUV39H2 Antibody Picoband® Fluoro488 Conjugated
A05361-2-Fluoro488 100 µg/Vial

Anti-KMT1B/SUV39H2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
VTI1B (Vesicle Transport Through Interaction with t-SNAREs Homolog 1B, Vesicle Transport v-SNARE Protein Vti1-like 1, Vti1-rp1, VTI1, VTI1L, VTI1L1, VTI2, v-SNARE, VTI1-LIKE) (FITC)
135304-FITC 100 µL

VTI1B (Vesicle Transport Through Interaction with t-SNAREs Homolog 1B, Vesicle Transport v-SNARE Protein Vti1-like 1, Vti1-rp1, VTI1, VTI1L, VTI1L1, VTI2, v-SNARE, VTI1-LIKE) (FITC)

Sign In for Pricing
View Details
2,2-Bis (4-cyanatophenyl) propane
FB33798-01 25 g

2,2-Bis (4-cyanatophenyl) propane

Sign In for Pricing
View Details