Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPA Rabbit Polyclonal Antibody (Biotin)

PTPA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP2A, PR53, PPP2R4

UniProt

Q15257

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_821068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Slc26a1 qPCR Primer Pair
QM59746S 200 Tests

Mouse Slc26a1 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Human PDGFRB Protein, ENLYFQ-tagged, Alexa Fluor 555 conjugated
PDGFRB-471HAF555 20 μg- 50 μg- 100 μg

Recombinant Human PDGFRB Protein, ENLYFQ-tagged, Alexa Fluor 555 conjugated

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)
MBS7033889-01 0.02 mg

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)
MBS7033889-02 0.1 mg

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)
MBS7033889-03 5x 0.1 mg

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG H&L, Cy5 conjugated
orb868590-01 100 µL

Goat Anti-Rabbit IgG H&L, Cy5 conjugated

Sign In for Pricing
View Details