Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPA Rabbit Polyclonal Antibody (Biotin)

PTPA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP2A, PR53, PPP2R4

UniProt

Q15257

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_821068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Ethylhexyl Acrylate 99% For Synthesis
118000500 500 mL

2-Ethylhexyl Acrylate 99% For Synthesis

Sign In for Pricing
View Details
TMEM59L (NM_012109) Human Over-expression Lysate
LS025789-20ug 20 µg

TMEM59L (NM_012109) Human Over-expression Lysate

Sign In for Pricing
View Details
CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1) (MaxLight 650)
MBS6221255-01 0.1 mL

CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1) (MaxLight 650)

Sign In for Pricing
View Details
CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1) (MaxLight 650)
MBS6221255-02 5x 0.1 mL

CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1) (MaxLight 650)

Sign In for Pricing
View Details
Rat Rnf208 Pre-designed siRNA Set B
SI212041B 1 Each

Rat Rnf208 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Rapgef3 shRNA (UAS) - Lentiviral mouse Rapgef3 shRNA (UAS, GFP) (100)
GTR15172569 1 Vial

Lentiviral mouse Rapgef3 shRNA (UAS) - Lentiviral mouse Rapgef3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details