Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPA Rabbit Polyclonal Antibody (HRP)

PTPA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP2A, PR53, PPP2R4

UniProt

Q15257

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_821068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hippocalcin (G-8) HRP
sc-393125 HRP 200 µg/mL

Hippocalcin (G-8) HRP

Sign In for Pricing
View Details
Lentiviral human FXR2 shRNA (UAS) - Lentiviral human FXR2 shRNA (UAS, GFP) (100)
GTR15331020 1 Vial

Lentiviral human FXR2 shRNA (UAS) - Lentiviral human FXR2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (HRP)
MBS6179647-01 0.1 mL

CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (HRP)

Sign In for Pricing
View Details
CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (HRP)
MBS6179647-02 5x 0.1 mL

CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (HRP)

Sign In for Pricing
View Details
Conoidin A
S9787-5mg 5 mg

Conoidin A

Sign In for Pricing
View Details
Growth Hormone Releasing Hormone (FITC)
547293 200 µL

Growth Hormone Releasing Hormone (FITC)

Sign In for Pricing
View Details