Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSTPIP2 Rabbit Polyclonal Antibody (HRP)

PSTPIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAYP

UniProt

Q9H939

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMDAIHKQKSLQFKKTMDAKKNYEQKCRDKDEAEQAVSRSANLVNPKQQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM18 (NM_014237) Human Over-expression Lysate
LC415414 20 µg

ADAM18 (NM_014237) Human Over-expression Lysate

Sign In for Pricing
View Details
UBE2G2 Antibody
orb1321478 100 µL

UBE2G2 Antibody

Sign In for Pricing
View Details
FGR (Ab-412) Antibody
E11-8105B 100 µg

FGR (Ab-412) Antibody

Sign In for Pricing
View Details
Cdc25A, phosphorylated (Ser79) (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A) (FITC) discontinued
C2560-01Z-FITC 200 µL

Cdc25A, phosphorylated (Ser79) (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A) (FITC) discontinued

Sign In for Pricing
View Details
CEP55, NT (Centrosomal Protein of 55kD, Cep55, Up-regulated In Colon Cancer 6, URCC6, C10orf3) (MaxLight 490) discontinued
C2617-88A-ML490 100 µL

CEP55, NT (Centrosomal Protein of 55kD, Cep55, Up-regulated In Colon Cancer 6, URCC6, C10orf3) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Guinea pig Parkinson Disease Protein 2 (PARK2) ELISA Kit
EIA07653Gu 1 Kit

Guinea pig Parkinson Disease Protein 2 (PARK2) ELISA Kit

Sign In for Pricing
View Details