Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSTPIP2 Rabbit Polyclonal Antibody (HRP)

PSTPIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAYP

UniProt

Q9H939

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMDAIHKQKSLQFKKTMDAKKNYEQKCRDKDEAEQAVSRSANLVNPKQQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuroendocrine convertase 1, PCSK1 ELISA Kit
MBS9334829-01 48 Well

Human Neuroendocrine convertase 1, PCSK1 ELISA Kit

Sign In for Pricing
View Details
Human Neuroendocrine convertase 1, PCSK1 ELISA Kit
MBS9334829-02 96 Well

Human Neuroendocrine convertase 1, PCSK1 ELISA Kit

Sign In for Pricing
View Details
Human Neuroendocrine convertase 1, PCSK1 ELISA Kit
MBS9334829-03 5x 96 Well

Human Neuroendocrine convertase 1, PCSK1 ELISA Kit

Sign In for Pricing
View Details
Human Neuroendocrine convertase 1, PCSK1 ELISA Kit
MBS9334829-04 10x 96 Well

Human Neuroendocrine convertase 1, PCSK1 ELISA Kit

Sign In for Pricing
View Details
AK3 Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF501819 100 µg

AK3 Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
ATP5G1P4 Adenovirus (Human)
12727051 1.0 mL

ATP5G1P4 Adenovirus (Human)

Sign In for Pricing
View Details