Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK1 Rabbit Polyclonal Antibody (HRP)

HOOK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HK1

UniProt

Q9UJC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REVFIRLQHENKMLRLQQEGSENERIEELQEQLEQKHRKMNELETEQRLS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Chloride, 0.5078 N
40120652-3 4 L

Sodium Chloride, 0.5078 N

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) RUVA Polyclonal Antibody
MBS7177513 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) RUVA Polyclonal Antibody

Sign In for Pricing
View Details
C2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6778908 1.0 µg DNA

C2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
WDR16 (FLJ37528, WD Repeat Domain 16, WDRPUH) discontinued
515816 100 µg

WDR16 (FLJ37528, WD Repeat Domain 16, WDRPUH) discontinued

Sign In for Pricing
View Details
DnaJC1 CRISPR Activation Plasmid (h2)
sc-410092-ACT-2 20 µg

DnaJC1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
THT-5-435-10 Pre-sized Labels for Printers
030228 10000 Roll (10000 Label (s) x 1 Roll)

THT-5-435-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details