Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pacsin3 Rabbit Polyclonal Antibody (HRP)

Pacsin3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AW413130, 4921507A02Rik, 6330413E15Rik

UniProt

Q99JB8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPGMAMNWPQFEEWSLDTQRAISRKEKGGRSPDEVTLTSIVPTRDGTAPP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCP1 (CTDP1) Rabbit Polyclonal Antibody
TA372558 100 µL

FCP1 (CTDP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Influenza A H5N1 Mouse Monoclonal Antibody [Clone ID: AT2B7]
AM39074PU-S 50 µL

Influenza A H5N1 Mouse Monoclonal Antibody [Clone ID: AT2B7]

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL
BNC681986-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Yeast Viability Staining Kit (Far-Red/Red)
#31063-3 1 Kit

Yeast Viability Staining Kit (Far-Red/Red)

Sign In for Pricing
View Details
2-Phenylethylamine hydrochloride
TRC-P335943-25G 25 g

2-Phenylethylamine hydrochloride

Sign In for Pricing
View Details
N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI5C5]
CF804203 100 µg

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI5C5]

Sign In for Pricing
View Details