Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLD3 Rabbit Polyclonal Antibody (HRP)

POLD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P66, P68, PPP1R128

UniProt

Q15054

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSNARE1 Protein Vector (Human) (pPB-C-His)
PV059365 500 ng

TSNARE1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse 2210408I21Rik shRNA (UAS) - Lentiviral mouse 2210408I21Rik shRNA (UAS, RFP) (100)
GTR15262476 1 Vial

Lentiviral mouse 2210408I21Rik shRNA (UAS) - Lentiviral mouse 2210408I21Rik shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SERPINB1 3'UTR GFP Stable Cell Line
TU072955 1.0 mL

SERPINB1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD151 Antibody (YA6963, Mouse)
HY-P87280-01 10 µL

CD151 Antibody (YA6963, Mouse)

Sign In for Pricing
View Details
CD151 Antibody (YA6963, Mouse)
HY-P87280-02 50 μL

CD151 Antibody (YA6963, Mouse)

Sign In for Pricing
View Details
CD151 Antibody (YA6963, Mouse)
HY-P87280-03 100 µL

CD151 Antibody (YA6963, Mouse)

Sign In for Pricing
View Details