Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA Rabbit Polyclonal Antibody (HRP)

BTLA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTLA1, CD272

UniProt

Q7Z6A9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_861445

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse A kinase interacting protein 1 (C11orf17) ELISA Kit
GTR10316302 96 Well

Mouse A kinase interacting protein 1 (C11orf17) ELISA Kit

Sign In for Pricing
View Details
FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 405) discontinued
126950-ML405 100 µL

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
VPP (Val-Pro-Pro)
002-07 5 mg

VPP (Val-Pro-Pro)

Sign In for Pricing
View Details
4 Hydroxynonenal Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6313R-BF555-TR 20 µL

4 Hydroxynonenal Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Sheep COMM domain-containing protein 3 (COMMD3) ELISA Kit
MBS7242392-01 48 Well

Sheep COMM domain-containing protein 3 (COMMD3) ELISA Kit

Sign In for Pricing
View Details
Sheep COMM domain-containing protein 3 (COMMD3) ELISA Kit
MBS7242392-02 96 Well

Sheep COMM domain-containing protein 3 (COMMD3) ELISA Kit

Sign In for Pricing
View Details