Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA Rabbit Polyclonal Antibody (HRP)

BTLA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTLA1, CD272

UniProt

Q7Z6A9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYSLLP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_861445

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL2 (NM_000586) Human Over-expression Lysate
LS003558 100 µg

IL2 (NM_000586) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit
MBS7241253-01 48 Well

Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit
MBS7241253-02 96 Well

Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit
MBS7241253-03 5x 96 Well

Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit
MBS7241253-04 10x 96 Well

Canine Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit

Sign In for Pricing
View Details
MFAP4 (Microfibrillar-associated Protein 4) (APC)
MBS6426651-01 0.1 mL

MFAP4 (Microfibrillar-associated Protein 4) (APC)

Sign In for Pricing
View Details