Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP4 Rabbit Polyclonal Antibody (FITC)

RASGRP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

C0LTP7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001139679

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 Rabbit Polyclonal Antibody
AP09500PU-S 50 µL

BRCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXO38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV710086 1.0 µg DNA

FBXO38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human UPF0760 protein C2orf29, C2orf29 ELISA Kit
MBS9343056-01 48 Well

Human UPF0760 protein C2orf29, C2orf29 ELISA Kit

Sign In for Pricing
View Details
Human UPF0760 protein C2orf29, C2orf29 ELISA Kit
MBS9343056-02 96 Well

Human UPF0760 protein C2orf29, C2orf29 ELISA Kit

Sign In for Pricing
View Details
Human UPF0760 protein C2orf29, C2orf29 ELISA Kit
MBS9343056-03 5x 96 Well

Human UPF0760 protein C2orf29, C2orf29 ELISA Kit

Sign In for Pricing
View Details
Human UPF0760 protein C2orf29, C2orf29 ELISA Kit
MBS9343056-04 10x 96 Well

Human UPF0760 protein C2orf29, C2orf29 ELISA Kit

Sign In for Pricing
View Details