Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP4 Rabbit Polyclonal Antibody (HRP)

RASGRP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

C0LTP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001139679

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY 255262
MBS5777607 Inquire

LY 255262

Sign In for Pricing
View Details
PDLIM5 Rabbit pAb
E45R26042N-100 100 µL

PDLIM5 Rabbit pAb

Sign In for Pricing
View Details
Rat Pyridoxal phosphate phosphatase ELISA Kit
MBS2885630-01 48 Well

Rat Pyridoxal phosphate phosphatase ELISA Kit

Sign In for Pricing
View Details
Rat Pyridoxal phosphate phosphatase ELISA Kit
MBS2885630-02 96 Well

Rat Pyridoxal phosphate phosphatase ELISA Kit

Sign In for Pricing
View Details
Rat Pyridoxal phosphate phosphatase ELISA Kit
MBS2885630-03 5x 96 Well

Rat Pyridoxal phosphate phosphatase ELISA Kit

Sign In for Pricing
View Details
Rat Pyridoxal phosphate phosphatase ELISA Kit
MBS2885630-04 10x 96 Well

Rat Pyridoxal phosphate phosphatase ELISA Kit

Sign In for Pricing
View Details