Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED18 Rabbit Polyclonal Antibody (Biotin)

MED18 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SRB5, p28b

UniProt

Q9BUE0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zinc finger protein 22, ZNF22 ELISA Kit
MBS9320537-01 48 Well

Rat Zinc finger protein 22, ZNF22 ELISA Kit

Sign In for Pricing
View Details
Rat Zinc finger protein 22, ZNF22 ELISA Kit
MBS9320537-02 96 Well

Rat Zinc finger protein 22, ZNF22 ELISA Kit

Sign In for Pricing
View Details
Rat Zinc finger protein 22, ZNF22 ELISA Kit
MBS9320537-03 5x 96 Well

Rat Zinc finger protein 22, ZNF22 ELISA Kit

Sign In for Pricing
View Details
Rat Zinc finger protein 22, ZNF22 ELISA Kit
MBS9320537-04 10x 96 Well

Rat Zinc finger protein 22, ZNF22 ELISA Kit

Sign In for Pricing
View Details
Human CellExp™ CD27 Ligand/ CD70, Fc Tag, Mouse Recombinant
P1367-10 10 µg

Human CellExp™ CD27 Ligand/ CD70, Fc Tag, Mouse Recombinant

Sign In for Pricing
View Details
ANKH, CT (ANKH, KIAA1581, Progressive ankylosis protein homolog) (MaxLight 650)
MBS6273540-01 0.1 mL

ANKH, CT (ANKH, KIAA1581, Progressive ankylosis protein homolog) (MaxLight 650)

Sign In for Pricing
View Details