Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED18 Rabbit Polyclonal Antibody (FITC)

MED18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SRB5, p28b

UniProt

Q9BUE0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_060108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aminoacylase/ACY1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07300 0.1 mg

Aminoacylase/ACY1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
TFAP2E Protein Vector (Human) (pPB-C-His)
PV135506 500 ng

TFAP2E Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Research Grade Vonsetamig
HX959196-01 100 µg

Research Grade Vonsetamig

Sign In for Pricing
View Details
Research Grade Vonsetamig
HX959196-02 1 mg

Research Grade Vonsetamig

Sign In for Pricing
View Details
PATL2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-19898R-BF488 100 µL

PATL2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
XCR1 CRISPR/Cas9 KO Plasmid (m)
sc-423854 20 µg

XCR1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details