Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED18 Rabbit Polyclonal Antibody (HRP)

MED18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRB5, p28b

UniProt

Q9BUE0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_060108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRBN Antibody
E312481 200 µL

CRBN Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL-3 R alpha/CD123 Antibody (6H6) [DyLight 488]
NB600-1185G 0.1 mL

Mouse Monoclonal IL-3 R alpha/CD123 Antibody (6H6) [DyLight 488]

Sign In for Pricing
View Details
Anti-SCD Antibody Picoband® Fluoro594 Conjugated
A00588-1-Fluoro594 100 µg/Vial

Anti-SCD Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
(D-Ala2) -Leu-Enkephalin
64963-01-5 Each

(D-Ala2) -Leu-Enkephalin

Sign In for Pricing
View Details
Equine IFN beta 1 ELISpot
orb2704864 1 Each

Equine IFN beta 1 ELISpot

Sign In for Pricing
View Details
Lentiviral human EGFR shRNA (UAS) - Lentiviral human EGFR shRNA (UAS, GFP) (100)
GTR15333912 1 Vial

Lentiviral human EGFR shRNA (UAS) - Lentiviral human EGFR shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details