Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGMAT Rabbit Polyclonal Antibody (Biotin)

AGMAT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ23384

UniProt

Q9BSE5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079034

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-17403R-BF555 100 µL

HIPK1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1, PARK5, PGP9.5, Uch-L1, Neuron cytoplasmic protein 9.5, Ubiquitin thioesterase L1, Ubiquitin carboxyl-terminal hydrolase isozyme L1)
365506 200 µL

UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1, PARK5, PGP9.5, Uch-L1, Neuron cytoplasmic protein 9.5, Ubiquitin thioesterase L1, Ubiquitin carboxyl-terminal hydrolase isozyme L1)

Sign In for Pricing
View Details
DST Antibody (FITC)
orb51232-01 50 µg

DST Antibody (FITC)

Sign In for Pricing
View Details
DST Antibody (FITC)
orb51232-02 100 µg

DST Antibody (FITC)

Sign In for Pricing
View Details
Thioredoxin Reductase 1, Cytoplasmic (TXNRD1) Antibody
abx003083-01 20 µL

Thioredoxin Reductase 1, Cytoplasmic (TXNRD1) Antibody

Sign In for Pricing
View Details
Thioredoxin Reductase 1, Cytoplasmic (TXNRD1) Antibody
abx003083-02 100 µL

Thioredoxin Reductase 1, Cytoplasmic (TXNRD1) Antibody

Sign In for Pricing
View Details