Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGMAT Rabbit Polyclonal Antibody (HRP)

AGMAT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ23384

UniProt

Q9BSE5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079034

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Abcb9 shRNA (UAS) - Lentiviral mouse Abcb9 shRNA (UAS, iRFP) plasmid
GTR15206248 1 Vial

Lentiviral mouse Abcb9 shRNA (UAS) - Lentiviral mouse Abcb9 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Particle Immuno Assay PIA-PINK-rabbit
PS-111 5 Blots

Particle Immuno Assay PIA-PINK-rabbit

Sign In for Pricing
View Details
EasyApp microplate film kit, includes dispenser and two 100-sheet EasyApp film rolls, -40C to +120C, sterile
2978-5887 Two 100-Sheet

EasyApp microplate film kit, includes dispenser and two 100-sheet EasyApp film rolls, -40C to +120C, sterile

Sign In for Pricing
View Details
VN1R4, ID (VN1R4, V1RL4, Vomeronasal type-1 receptor 4, G-protein coupled receptor GPCR27, V1r-like receptor 4) (APC)
MBS6362665-01 0.2 mL

VN1R4, ID (VN1R4, V1RL4, Vomeronasal type-1 receptor 4, G-protein coupled receptor GPCR27, V1r-like receptor 4) (APC)

Sign In for Pricing
View Details
VN1R4, ID (VN1R4, V1RL4, Vomeronasal type-1 receptor 4, G-protein coupled receptor GPCR27, V1r-like receptor 4) (APC)
MBS6362665-02 5x 0.2 mL

VN1R4, ID (VN1R4, V1RL4, Vomeronasal type-1 receptor 4, G-protein coupled receptor GPCR27, V1r-like receptor 4) (APC)

Sign In for Pricing
View Details
Diamine Oxidase Activity Fluorometric Microplate Assay Kit
orb3073186 100 assay

Diamine Oxidase Activity Fluorometric Microplate Assay Kit

Sign In for Pricing
View Details