Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL19 Rabbit Polyclonal Antibody (FITC)

MRPL19 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RLX1, L19mt, MRPL15, RPML15, MRP-L15, MRP-L19

UniProt

P49406

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_055578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant S Protein RBD (Mammalian, K458R, C-6His)
DRA78-1mg 1 mg

Recombinant S Protein RBD (Mammalian, K458R, C-6His)

Sign In for Pricing
View Details
Phospho-cdc25A (Ser124) Rabbit Polyclonal Antibody (BF405)
orb2284276 100 µL

Phospho-cdc25A (Ser124) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Mouse Nitric Oxide Synthase, Inducible (NOS2) CLIA Kit
abx492111-01 96 Tests

Mouse Nitric Oxide Synthase, Inducible (NOS2) CLIA Kit

Sign In for Pricing
View Details
Mouse Nitric Oxide Synthase, Inducible (NOS2) CLIA Kit
abx492111-02 5x 96 Tests

Mouse Nitric Oxide Synthase, Inducible (NOS2) CLIA Kit

Sign In for Pricing
View Details
Mouse Nitric Oxide Synthase, Inducible (NOS2) CLIA Kit
abx492111-03 10x 96 Tests

Mouse Nitric Oxide Synthase, Inducible (NOS2) CLIA Kit

Sign In for Pricing
View Details
Mouse Anti-CTRP7 Polyclonal Antibody
CTA-443-01 100 µg

Mouse Anti-CTRP7 Polyclonal Antibody

Sign In for Pricing
View Details