Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOMM70 Rabbit Polyclonal Antibody (HRP)

TOMM70 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tom70, TOMM70A

UniProt

O94826

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055635

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PR domain-containing protein 11, PRDM11 ELISA KIT
ELI-36153h 96 Tests

Human PR domain-containing protein 11, PRDM11 ELISA KIT

Sign In for Pricing
View Details
Rabbit Anti-Human NCSTN pAb
PA8125-01 50 μL

Rabbit Anti-Human NCSTN pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NCSTN pAb
PA8125-02 100 μL

Rabbit Anti-Human NCSTN pAb

Sign In for Pricing
View Details
2-Ethylhexyl acetate
105550 500 500 mL

2-Ethylhexyl acetate

Sign In for Pricing
View Details
GALM Knockout Hela Polyclonal Cells
ARG8390 1 Million

GALM Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Human SLC6A5 Protein Lysate
MBS8419754-01 0.02 mg

Human SLC6A5 Protein Lysate

Sign In for Pricing
View Details