Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOMM70 Rabbit Polyclonal Antibody (HRP)

TOMM70 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tom70, TOMM70A

UniProt

O94826

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055635

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri Glucans biosynthesis protein D (mdoD), partial
MBS1304678 Inquire

Recombinant Shigella flexneri Glucans biosynthesis protein D (mdoD), partial

Sign In for Pricing
View Details
Rabbit Monoclonal Chordin Antibody (065) [Alexa Fluor 647]
NBP2-89221AF647 0.1 mL

Rabbit Monoclonal Chordin Antibody (065) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human THSD7A Protein CF
9524-TH-050 50 µg

Recombinant Human THSD7A Protein CF

Sign In for Pricing
View Details
UNC5A ORF Vector (Human) (pORF)
ORF035499 1.0 µg DNA

UNC5A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Monkey Translocation Associated Membrane Protein 1 ELISA Kit
MBS056338-01 48 Well

Monkey Translocation Associated Membrane Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Translocation Associated Membrane Protein 1 ELISA Kit
MBS056338-02 96 Well

Monkey Translocation Associated Membrane Protein 1 ELISA Kit

Sign In for Pricing
View Details