Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atpaf2 Rabbit Polyclonal Antibody (FITC)

Atpaf2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

D3ZTW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Atpaf2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TEWDSQQDTIKFYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTIC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100476

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit
MBS060228-01 48 Well

Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details
Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit
MBS060228-02 96 Well

Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details
Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit
MBS060228-03 5x 96 Well

Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details
Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit
MBS060228-04 10x 96 Well

Camel Receptor I For The Fc Region of Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details
Human TFF2 (Trefoil Factor 2) ELISA Kit
MBS8800771-01 48 Strip Well

Human TFF2 (Trefoil Factor 2) ELISA Kit

Sign In for Pricing
View Details
Human TFF2 (Trefoil Factor 2) ELISA Kit
MBS8800771-02 96 Strip Well

Human TFF2 (Trefoil Factor 2) ELISA Kit

Sign In for Pricing
View Details