Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L2 Rabbit Polyclonal Antibody (HRP)

TPD52L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D54, TPD54

UniProt

O43399

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TPD52L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1AN Blocking peptide
orb1443609 500 µg

HIF1AN Blocking peptide

Sign In for Pricing
View Details
Von Willebrand Factor/VWF Rabbit Polyclonal Antibody (Fluoro647)
orb3078171 100 µg

Von Willebrand Factor/VWF Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Mouse Cytochrome P450 (CYP450) ELISA Kit
MBS3805805-01 48 Well

Mouse Cytochrome P450 (CYP450) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 (CYP450) ELISA Kit
MBS3805805-02 96 Well

Mouse Cytochrome P450 (CYP450) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 (CYP450) ELISA Kit
MBS3805805-03 5x 96 Well

Mouse Cytochrome P450 (CYP450) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 (CYP450) ELISA Kit
MBS3805805-04 10x 96 Well

Mouse Cytochrome P450 (CYP450) ELISA Kit

Sign In for Pricing
View Details