Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3K Rabbit Polyclonal Antibody (Biotin)

EIF3K Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

M9, ARG134, PLAC24, PTD001, EIF3S12, HSPC029, MSTP001, PLAC-24, PRO1474, EIF3-p28

UniProt

Q9UBQ5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037366

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKP2 Protein Vector (Mouse) (pPM-C-His)
PV216637 500 ng

PKP2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
IgG1 Negative Isotype Control (MaxLight 650) discontinued
I1904-79F-ML650 100 µL

IgG1 Negative Isotype Control (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-Human UNC45A Polyclonal Antibody
HP748014-01 50 µg

Anti-Human UNC45A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human UNC45A Polyclonal Antibody
HP748014-02 100 µg

Anti-Human UNC45A Polyclonal Antibody

Sign In for Pricing
View Details
Porcine FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2509208-01 24 Tests

Porcine FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2509208-02 48 Tests

Porcine FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details