Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3K Rabbit Polyclonal Antibody (HRP)

EIF3K Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

M9, ARG134, PLAC24, PTD001, EIF3S12, HSPC029, MSTP001, PLAC-24, PRO1474, EIF3-p28

UniProt

Q9UBQ5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037366

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 (26-35) (human) trifluoroacetate salt
FM109182-01 500 µg

MART-1 (26-35) (human) trifluoroacetate salt

Sign In for Pricing
View Details
MART-1 (26-35) (human) trifluoroacetate salt
FM109182-02 1000 µg

MART-1 (26-35) (human) trifluoroacetate salt

Sign In for Pricing
View Details
MART-1 (26-35) (human) trifluoroacetate salt
FM109182-03 2000 µg

MART-1 (26-35) (human) trifluoroacetate salt

Sign In for Pricing
View Details
MART-1 (26-35) (human) trifluoroacetate salt
FM109182-04 5000 μg

MART-1 (26-35) (human) trifluoroacetate salt

Sign In for Pricing
View Details
MART-1 (26-35) (human) trifluoroacetate salt
FM109182-05 10000 μg

MART-1 (26-35) (human) trifluoroacetate salt

Sign In for Pricing
View Details
Porcine Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit
MBS455850-01 48 Tests

Porcine Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit

Sign In for Pricing
View Details