Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif3k Rabbit Polyclonal Antibody (HRP)

Eif3k Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF3, Eif3s, Eif3s12, 1200009C21Rik

UniProt

Q9DBZ5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R-IMPP 5mg
A20678-5 5 mg

R-IMPP 5mg

Sign In for Pricing
View Details
Cacna2d2 siRNA Oligos set (Mouse)
14891174 3x 5 nmol

Cacna2d2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
MRP-L34 HDR Plasmid (h)
sc-413068-HDR 20 µg

MRP-L34 HDR Plasmid (h)

Sign In for Pricing
View Details
Anti Human CD64 Flow Cytometry Monoclonal Clone 101 FITC Ready To Use 200 Tests
IMSAHUCD64101CFITC200 200 Tests

Anti Human CD64 Flow Cytometry Monoclonal Clone 101 FITC Ready To Use 200 Tests

Sign In for Pricing
View Details
KNL2 (m) -PR
sc-141932-PR 10 µM - 20 µL

KNL2 (m) -PR

Sign In for Pricing
View Details
NACC1 Stable Knockdown CT26 Cell Line #11 P3
T9543 1x106 cells / 1.0 mL

NACC1 Stable Knockdown CT26 Cell Line #11 P3

Sign In for Pricing
View Details