Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP3 Rabbit Polyclonal Antibody (HRP)

GBP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GBP3

UniProt

Q9H0R5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GBP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILTEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUMBL Antibody
A72667-100UG 100 µg

NUMBL Antibody

Sign In for Pricing
View Details
FKBP5 (F1G3I) Rabbit Monoclonal Antibody
CST 27140S 100 µL

FKBP5 (F1G3I) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Adrenergic Receptor Kinase, beta 1 (bARK1, B1 AR, ARK1 beta, G-Protein Coupled Receptor Kinase 2, GPCR K2, GRK2) (MaxLight 550)
MBS6259595-01 0.1 mL

Adrenergic Receptor Kinase, beta 1 (bARK1, B1 AR, ARK1 beta, G-Protein Coupled Receptor Kinase 2, GPCR K2, GRK2) (MaxLight 550)

Sign In for Pricing
View Details
Adrenergic Receptor Kinase, beta 1 (bARK1, B1 AR, ARK1 beta, G-Protein Coupled Receptor Kinase 2, GPCR K2, GRK2) (MaxLight 550)
MBS6259595-02 5x 0.1 mL

Adrenergic Receptor Kinase, beta 1 (bARK1, B1 AR, ARK1 beta, G-Protein Coupled Receptor Kinase 2, GPCR K2, GRK2) (MaxLight 550)

Sign In for Pricing
View Details
LCAT (Lecithin-Cholesterol Acyltransferase) (MaxLight 490)
MBS6207121-01 0.1 mL

LCAT (Lecithin-Cholesterol Acyltransferase) (MaxLight 490)

Sign In for Pricing
View Details
LCAT (Lecithin-Cholesterol Acyltransferase) (MaxLight 490)
MBS6207121-02 5x 0.1 mL

LCAT (Lecithin-Cholesterol Acyltransferase) (MaxLight 490)

Sign In for Pricing
View Details