Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP3 Rabbit Polyclonal Antibody (FITC)

GBP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp686E0974, DKFZp686L15228, FLJ10961

UniProt

Q9H0R5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf229-set siRNA/shRNA/RNAi Lentivector (Human)
14196091 4x 500 ng

C1orf229-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
FBXO21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0764905 3x 1.0 µg

FBXO21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bpifa2 Rat shRNA Lentiviral Particle (Locus ID 50585)
TL711719V 500 µL Each

Bpifa2 Rat shRNA Lentiviral Particle (Locus ID 50585)

Sign In for Pricing
View Details
Horse Aldolase C, Fructose Bisphosphate ELISA Kit
MBS104588-01 48 Well

Horse Aldolase C, Fructose Bisphosphate ELISA Kit

Sign In for Pricing
View Details
Horse Aldolase C, Fructose Bisphosphate ELISA Kit
MBS104588-02 96 Well

Horse Aldolase C, Fructose Bisphosphate ELISA Kit

Sign In for Pricing
View Details
Horse Aldolase C, Fructose Bisphosphate ELISA Kit
MBS104588-03 5x 96 Well

Horse Aldolase C, Fructose Bisphosphate ELISA Kit

Sign In for Pricing
View Details