Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLPH3 Rabbit Polyclonal Antibody (FITC)

GOLPH3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GOPP1, GPP34, MIDAS, Vps74

UniProt

Q9H4A6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071413

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBR2 Knockout HEK293T cell line
GTR15413023 1 Vial

Human UBR2 Knockout HEK293T cell line

Sign In for Pricing
View Details
ACAT1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62678R-BF350 100 µL

ACAT1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
WASL (Wiskott-Aldrich Syndrome Gene-like Protein, Wiskott Aldrich Syndrome Like, NWASP, N-WASP) discontinued
214159-01 20 µL

WASL (Wiskott-Aldrich Syndrome Gene-like Protein, Wiskott Aldrich Syndrome Like, NWASP, N-WASP) discontinued

Sign In for Pricing
View Details
WASL (Wiskott-Aldrich Syndrome Gene-like Protein, Wiskott Aldrich Syndrome Like, NWASP, N-WASP) discontinued
214159-02 100 µL

WASL (Wiskott-Aldrich Syndrome Gene-like Protein, Wiskott Aldrich Syndrome Like, NWASP, N-WASP) discontinued

Sign In for Pricing
View Details
Human Hepatoma Derived Growth Factor (HDGF) Protein
abx261882-01 5 µg

Human Hepatoma Derived Growth Factor (HDGF) Protein

Sign In for Pricing
View Details
Human Hepatoma Derived Growth Factor (HDGF) Protein
abx261882-02 20 µg

Human Hepatoma Derived Growth Factor (HDGF) Protein

Sign In for Pricing
View Details