Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLPH3 Rabbit Polyclonal Antibody (HRP)

GOLPH3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GOPP1, GPP34, MIDAS, Vps74

UniProt

Q9H4A6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071413

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphoenolpyruvic acid, tricyclohexylammonium salt
BIP0690 250 mg

Phosphoenolpyruvic acid, tricyclohexylammonium salt

Sign In for Pricing
View Details
Guinea Pig leukotriene D4, LT-D4 ELISA Kit
MBS9300741 Inquire

Guinea Pig leukotriene D4, LT-D4 ELISA Kit

Sign In for Pricing
View Details
BIRC7 Protein Vector (Human) (pPB-His-GST)
PV326971 500 ng

BIRC7 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
CLLU1OS 3'UTR Luciferase Stable Cell Line
TU004595 1.0 mL

CLLU1OS 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
COQ3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0490303 1.0 µg DNA

COQ3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Tryptic Soy Broth w/o Dextrose (TSB) (Powder)
T8727-15 500 g

Tryptic Soy Broth w/o Dextrose (TSB) (Powder)

Sign In for Pricing
View Details