Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hrh3 Rabbit Polyclonal Antibody (FITC)

Hrh3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9QYN8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hrh3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_445958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEB1, CT (TCEB1, Transcription elongation factor B polypeptide 1, Elongin 15kD subunit, Elongin-C, RNA polymerase II transcription factor SIII subunit C, SIII p15) (MaxLight 405) discontinued
042688-ML405 100 µL

TCEB1, CT (TCEB1, Transcription elongation factor B polypeptide 1, Elongin 15kD subunit, Elongin-C, RNA polymerase II transcription factor SIII subunit C, SIII p15) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ECE-1, CT (ECE1, Endothelin-converting enzyme 1) (MaxLight 750) discontinued
034901-ML750 100 µL

ECE-1, CT (ECE1, Endothelin-converting enzyme 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KLK13 antibody
70R-3265 100 µL

KLK13 antibody

Sign In for Pricing
View Details
Tert-Butyl 3-Bromo-5,6-Dihydrospiro[Piperidine-4,7-Pyrrolo[1,2-A]Imidazole]-1-Carboxylate
BAC00016-01 50 mg

Tert-Butyl 3-Bromo-5,6-Dihydrospiro[Piperidine-4,7-Pyrrolo[1,2-A]Imidazole]-1-Carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3-Bromo-5,6-Dihydrospiro[Piperidine-4,7-Pyrrolo[1,2-A]Imidazole]-1-Carboxylate
BAC00016-02 0.5 g

Tert-Butyl 3-Bromo-5,6-Dihydrospiro[Piperidine-4,7-Pyrrolo[1,2-A]Imidazole]-1-Carboxylate

Sign In for Pricing
View Details
Olr1493 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
33982156 3x 1.0 µg DNA

Olr1493 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details