Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNBL1 Rabbit Polyclonal Antibody (FITC)

CTNNBL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NAP, P14L, PP8304, C20orf33, dJ633O20.1

UniProt

Q8WYA6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_110517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1469 3'UTR GFP Stable Cell Line
TU264758 1.0 mL

Olr1469 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
gamma Catenin (JUP) Rabbit Polyclonal Antibody
TA321451 100 µL

gamma Catenin (JUP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF354A Rabbit Polyclonal Antibody (FITC)
orb2136663 100 µL

ZNF354A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Idh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6774207 1.0 µg DNA

Idh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lama1 Rat Pre-designed siRNA Set A
HY-RS27493 1 Set

Lama1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
OsTIFY11B Rabbit Polyclonal Antibody
E580680-A-SE 100 µL

OsTIFY11B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details