Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KSR2 Rabbit Polyclonal Antibody (FITC)

KSR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6VAB6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence MIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQLSCKKKVAL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQLSCKKKVAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_775869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BRIP1/FANCJ Antibody
NBP1-31883 0.1 mL

Rabbit Polyclonal BRIP1/FANCJ Antibody

Sign In for Pricing
View Details
FLNC Recombinant Protein
OPCD03267-200UG 200 µg

FLNC Recombinant Protein

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)
MBS6374938-01 0.1 mL

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)
MBS6374938-02 5x 0.1 mL

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit anti-Seladin-1 Antibody
MBS4507538-01 0.05 mL

Rabbit anti-Seladin-1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Seladin-1 Antibody
MBS4507538-02 0.1 mL

Rabbit anti-Seladin-1 Antibody

Sign In for Pricing
View Details