Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KSR2 Rabbit Polyclonal Antibody (HRP)

KSR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6VAB6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence MIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQLSCKKKVAL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQLSCKKKVAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_775869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS12P16 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV783040 1.0 µg DNA

RPS12P16 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Rat CACYBP Protein, His (Fc)-Avi-tagged
CACYBP-743R 50 µg

Recombinant Rat CACYBP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PerCP Anti-Human CD8a Antibody
JOT21340F 20Tests

PerCP Anti-Human CD8a Antibody

Sign In for Pricing
View Details
SSH1, NT (SSH1, KIAA1298, SSH1L, Protein phosphatase Slingshot homolog 1, SSH-like protein 1) (MaxLight 550) discontinued
042326-ML550 100 µL

SSH1, NT (SSH1, KIAA1298, SSH1L, Protein phosphatase Slingshot homolog 1, SSH-like protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lmo2 (NM_001244779) Rat Untagged Clone
RN215927 10 µg

Lmo2 (NM_001244779) Rat Untagged Clone

Sign In for Pricing
View Details
Influenza A H1N1 (A/New Caledonia/20/1999) Hemagglutinin / HA Protein (His Tag)
E45O55094M2-100 100 µg

Influenza A H1N1 (A/New Caledonia/20/1999) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details