Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnalc1 Rabbit Polyclonal Antibody (HRP)

Dnalc1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dn, Dna, Dnalc1, AW121714, 1700010H15Rik, E330027P08Rik

UniProt

Q05A62

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dnalc1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083097

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig EDN1 ELISA Kit
orb436913-01 48 Tests

Guinea pig EDN1 ELISA Kit

Sign In for Pricing
View Details
Guinea pig EDN1 ELISA Kit
orb436913-02 96 Tests

Guinea pig EDN1 ELISA Kit

Sign In for Pricing
View Details
Vopikitug (Reference antibody)
E55B1028 100 µg

Vopikitug (Reference antibody)

Sign In for Pricing
View Details
Calcium/calmodulin-dependent Protein Kinase Type 1D (CAMK1D) BioAssayTM ELISA Kit (Human) discontinued
587444 96 Tests

Calcium/calmodulin-dependent Protein Kinase Type 1D (CAMK1D) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Lysozyme (E)
orb1649802-01 20 µg

Recombinant Enterobacteria phage T4 Lysozyme (E)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Lysozyme (E)
orb1649802-02 100 µg

Recombinant Enterobacteria phage T4 Lysozyme (E)

Sign In for Pricing
View Details